SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A062SZ75 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A062SZ75
Domain Number 1 Region: 3-100
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.19e-28
Family Chaperone J-domain 0.0004
Further Details:      
 
Domain Number 2 Region: 223-304
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.00000000000000249
Family HSP40/DnaJ peptide-binding domain 0.0082
Further Details:      
 
Domain Number 3 Region: 137-217
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.0000000000000968
Family HSP40/DnaJ peptide-binding domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A062SZ75
Sequence length 320
Comment (tr|A0A062SZ75|A0A062SZ75_ACIBA) DnaJ C terminal domain protein {ECO:0000313|EMBL:KCZ34752.1} KW=Complete proteome OX=1310913 OS=Acinetobacter baumannii 25977_9. GN=J812_0400 OC=Acinetobacter calcoaceticus/baumannii complex.
Sequence
MAKNYYEELGVKREASADEIKKAYRKLARKYHPDISKEKDAEEKMQAINVAYDTLSNAEK
KAEYDQMLDHPQGFNGFGQGAAQGGFDGARFYRQGFTGGSGEQADFSGFEDLFGRFGAGF
GGGQQQYQRQQRSYRGEDQHASIEVDLDIAYHGSTQQITLQIPTVNVYGEPEVQRKTLQV
KIPKGMKEGQQIRLSGQGQSGINGGANGDLYIEIQYKDTNRVHVEGSDVYLTVDVAPWEA
ALGQGIEVKTPAGPLHVNLPKNAKQGQQLRLKDKGIPNKTPGHLYLILNIVFPPVHSEKE
KEAYQQLAEAFASFEPRSSH
Download sequence
Identical sequences A0A014BPZ3 A0A014C283 A0A014CEQ5 A0A014CJ66 A0A014CSX6 A0A014DS20 A0A014DUR5 A0A014EJL7 A0A062L3R6 A0A062N4W6 A0A062SZ75
WP_017393991.1.100576 WP_017393991.1.16924 WP_017393991.1.17678 WP_017393991.1.21600 WP_017393991.1.21774 WP_017393991.1.29521 WP_017393991.1.31793 WP_017393991.1.370 WP_017393991.1.53546 WP_017393991.1.53558 WP_017393991.1.70478 WP_017393991.1.74078 WP_017393991.1.79917 WP_017393991.1.80429 WP_017393991.1.92445 WP_017393991.1.9755 WP_017393991.1.98939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]