SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A062TT68 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A062TT68
Domain Number 1 Region: 3-89
Classification Level Classification E-value
Superfamily Chaperone J-domain 3.4e-26
Family Chaperone J-domain 0.0006
Further Details:      
 
Domain Number 2 Region: 131-210
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 3.4e-18
Family HSP40/DnaJ peptide-binding domain 0.0018
Further Details:      
 
Domain Number 3 Region: 208-280
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 4.58e-16
Family HSP40/DnaJ peptide-binding domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A062TT68
Sequence length 292
Comment (tr|A0A062TT68|A0A062TT68_9RHOB) Uncharacterized protein {ECO:0000313|EMBL:KCZ51171.1} KW=Complete proteome; Reference proteome OX=1280941 OS=Hyphomonas sp. T16B2. GN=HY2_12060 OC=Hyphomonadaceae; Hyphomonas.
Sequence
MALDPYKVLGVDRKASEAEIKKAYRQKAKALHPDLHPDDNKKAEEFKRVSQAWDILGDKE
KRAKFDRGEIDGDGNPAGFGGGGGGFPGGSPNGGFRWESRGGDPFGGAQGDPFEDILSGM
FGGRGRRNAGPMKGRDVRYRVSIDFADAVTGARRRMTMADGTALDVNIPAGIESGQTLRL
KSQGQQSPNGGPPGDAMLEVEVKPSKVWERDGKDIRMSVPVSLKVAVLGGSVDVKTPSGT
VTLKVPAGSNTGSQLRLRGKGVQSTPPGNLYARLEIVLDDPKDESLKKWAEG
Download sequence
Identical sequences A0A062TT68
WP_034826082.1.86936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]