SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A062UZ25 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A062UZ25
Domain Number 1 Region: 3-146
Classification Level Classification E-value
Superfamily Ferritin-like 2.42e-39
Family Ferritin 0.0000127
Further Details:      
 
Domain Number 2 Region: 147-189
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.00000000000381
Family Rubredoxin 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A062UZ25
Sequence length 190
Comment (tr|A0A062UZ25|A0A062UZ25_9EURY) Rubrerythrin {ECO:0000313|EMBL:KCZ70402.1} KW=Complete proteome; Reference proteome OX=1392998 OS=Candidatus Methanoperedens nitroreducens. GN=ANME2D_03317 OC=Candidatus Methanoperedenaceae; Candidatus Methanoperedens.
Sequence
MNLKGSRTEKNLLAAFAGESQARNRYTYFAGVAGKEGFEQISGIFLETADNEKEHAEVFF
KYLEGGNVEITSAYPAGVIGKTADNLLAAAEGEKLEWGTLYPGFARVAEEEGFSQVASSF
TEIGEVEQFHESRYRALLENLKDGSVFKKKSTVKWHCRNCGYIHEGTEAPKVCPACKHAQ
SYYEVLAQNW
Download sequence
Identical sequences A0A062UZ25
WP_048093937.1.47093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]