SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A063B9N0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A063B9N0
Domain Number 1 Region: 59-70,130-225
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 0.00000000109
Family TolA 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A063B9N0
Sequence length 233
Comment (tr|A0A063B9N0|A0A063B9N0_9BURK) TonB family protein {ECO:0000313|EMBL:KDB08130.1} KW=Complete proteome; Reference proteome OX=1192124 OS=Burkholderia sp. lig30. GN=LIG30_2654 OC=Burkholderiaceae; Burkholderia.
Sequence
MEMTYNGGPPRKGPRRYVKPVVLALALAGVAALIWHFAGDTAGVKRVSAPQVTTVIPLPP
PPPPPPKQKPPPETVREEVKTPVDRPTVAPKPSETPKPSDDQPKQMTMNAPAQAGTDSFN
IGAGDGSGMVGSGGGGRFGNAGYSQYLGSVLQRAVEQDKRVQDAGGLRFSASLNLWLDPA
GRITRVAIGQSAGDPRLDAALIAAVESLGKIDEPPPPGVTYPKWVRLSGRKPG
Download sequence
Identical sequences A0A063B9N0
WP_051994995.1.68174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]