SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A063BCY0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A063BCY0
Domain Number 1 Region: 40-158
Classification Level Classification E-value
Superfamily PapD-like 4.45e-25
Family Pilus chaperone 0.0045
Further Details:      
 
Domain Number 2 Region: 162-243
Classification Level Classification E-value
Superfamily Periplasmic chaperone C-domain 0.00000314
Family Periplasmic chaperone C-domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A063BCY0
Sequence length 255
Comment (tr|A0A063BCY0|A0A063BCY0_9BURK) Pili assembly chaperone {ECO:0000313|EMBL:KDB06554.1} KW=Complete proteome; Reference proteome OX=1192124 OS=Burkholderia sp. lig30. GN=LIG30_3960 OC=Burkholderiaceae; Burkholderia.
Sequence
MRSRLSPPCSPARRRAEPARRRWWGELLLALNCAALPAAALAAGVQPESSVVILNESDGE
TTMNVRNTEDSPLLLHTAIQNLPEDNELLVVAVPPISRVEAKETQLVRFLMQSAEPIKVQ
RLKRVTFEGIPPKAADGTSRISMTVRQNLPLIIHPANLPKNAEPWKLLKLSLDDRKLRVV
NDSAYVVRLAQNVEMLPDRTQVDIGTTYLLPGSELSVALPPAGSATPAAVRISPASAYGY
SSETYDIPLGAAAKR
Download sequence
Identical sequences A0A063BCY0
WP_083494104.1.68174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]