SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A063BRU6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A063BRU6
Domain Number 1 Region: 352-464,507-530
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000000177
Family Regulator of G-protein signaling, RGS 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A063BRU6
Sequence length 544
Comment (tr|A0A063BRU6|A0A063BRU6_9HYPO) Uncharacterized protein {ECO:0000313|EMBL:KDB11847.1} KW=Complete proteome; Reference proteome OX=1159556 OS=Ustilaginoidea virens. GN=UV8b_7270 OC=Hypocreales incertae sedis; Ustilaginoidea.
Sequence
MGSELGVTKDTQPVARLDGLGIFYIVFAISWTAILFSGMAFLWLKREMPILRIRCLGLSF
TAISFLHCYFFCVTTGYVYGPLMAEVVEFWIMAIWVPFGIALFHAANSRFLYVANAQKKY
VDKTVDFGWDGKRPRIRKTLVARWKMLPYTRRVLILVGLGMVLHVVLTVFTFLISRKFHS
SWGIAGTEVTGTAMEKKYEQGRGWEWWPSVFWQIFWSWVVAPVILWRSRNLKDSQGWRTQ
TIACCLSGLFAAPMWLIALYVPGMAVVNNYWIPPMWIALSIMMLEIFTVFIPVWQVYKQQ
SLCQETLDSIARWESRQKSVVHSGKSLASASSSALSWMGRTKAGSISSTGGSILTMDALE
HTLAKNPEPLQEFSALRDFSGENIAFLTRVREWRARYVVHAAGGGVLGEKDPATTTLALT
RESYESALRIYVDFISSHSAEFQVNLSSQDFKNLQAIFEGAAQVVTGECGSPDPATPFAS
APKRHDDHHAEPIRYTGEIPEAFSEGVFDDAEMSIKYLVLTNTWPKFIRERRSLDVVSGI
ESVM
Download sequence
Identical sequences A0A063BRU6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]