SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A063BS73 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A063BS73
Domain Number 1 Region: 80-156
Classification Level Classification E-value
Superfamily ISP domain 0.000000000000021
Family Rieske iron-sulfur protein (ISP) 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A063BS73
Sequence length 234
Comment (tr|A0A063BS73|A0A063BS73_9HYPO) Rieske domain-containing protein {ECO:0000313|EMBL:KDB13071.1} KW=Complete proteome; Reference proteome OX=1159556 OS=Ustilaginoidea virens. GN=UV8b_6071 OC=Hypocreales incertae sedis; Ustilaginoidea.
Sequence
MNLFRSRPDTSWVPVGPASSFPDLGEDTGSLLESRLCDAKLQPGCKIFRVPKDDPSKSEQ
VFLSSDDPEAPGRGDDLLDQVLIFRYRGRFHAVDHRCPHSAYPLSNGMPFDIEDFGVRLS
AGLTCPKHGWAFDLFTGMADTGRYKLAVWELQLRDGSGTKVIDPLADESDHVNRTLWPAE
EEMLAGPKVWLRAWEWFKPRQLLANDRIYHTAEVEHLPGCCPYFHRVQGVVVGL
Download sequence
Identical sequences A0A063BS73

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]