SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A063UDC7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A063UDC7
Domain Number 1 Region: 2-79
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 0.00000000000000288
Family TolA 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A063UDC7
Sequence length 84
Comment (tr|A0A063UDC7|A0A063UDC7_BORBO) TonB protein, C-terminal domain protein {ECO:0000313|EMBL:KDD58364.1} KW=Complete proteome OX=1331242 OS=Bordetella bronchiseptica OSU553. GN=L533_4571 OC=Alcaligenaceae; Bordetella.
Sequence
MRACVQPGVAYPPPPRAGSANPTAQYRVQLGSDGKVNGVTLTSSSGNPGFDRAVETGIRR
CNPFPKPSTGRYEPIIDVVYRMYD
Download sequence
Identical sequences A0A063UDC7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]