SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A064AC83 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A064AC83
Domain Number 1 Region: 23-149
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000405
Family SMI1/KNR4-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A064AC83
Sequence length 156
Comment (tr|A0A064AC83|A0A064AC83_9FUSO) Uncharacterized protein {ECO:0000313|EMBL:KDE72587.1} KW=Complete proteome OX=1441736 OS=Fusobacterium necrophorum BFTR-2. GN=FUSO7_08050 OC=Fusobacterium.
Sequence
MSDFTFLRAYKVINEEQNNGLDTVFYPVTDEEITSLETELQSKLPAELADFYSQVGYDFI
KKGTGKRNLFMDTYSLQDINLRRGDFEYDPDLEIYADIYNDDKLLFFEVNEGVYLAIDKF
DNKEKNAVYYFKDKIADSLEELIHKILEQPDFLNEY
Download sequence
Identical sequences A0A064AC83 A0A0E2V1E6
WP_051619433.1.18817 WP_051619433.1.31366 WP_051619433.1.58954 WP_051619433.1.74434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]