SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A064ALJ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A064ALJ4
Domain Number 1 Region: 30-155
Classification Level Classification E-value
Superfamily Ecotin, trypsin inhibitor 4.19e-39
Family Ecotin, trypsin inhibitor 0.0000905
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A064ALJ4
Sequence length 159
Comment (tr|A0A064ALJ4|A0A064ALJ4_9FUSO) Ecotin {ECO:0000313|EMBL:KDE74415.1} KW=Complete proteome OX=1441736 OS=Fusobacterium necrophorum BFTR-2. GN=FUSO7_02845 OC=Fusobacterium.
Sequence
MKKCIYAIGLLFSFYVSVFAMQHPDMNLEIYPKAKQGMKKVVYLLEKKEKEEDYKLEIKF
GKDLVVDDNLHHFLGGKLEEKDVKGWGYPYYIFSGDSQMAQTLMAFPLGSEREKRVYYPT
ATKILPYHSKLPLVLYVPEDVKVEVSLWNRMQEIKEVSR
Download sequence
Identical sequences A0A064ALJ4
WP_035914657.1.58954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]