SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A064CPI1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A064CPI1
Domain Number - Region: 159-201
Classification Level Classification E-value
Superfamily MbtH-like 0.0301
Family MbtH-like 0.015
Further Details:      
 
Domain Number - Region: 187-252
Classification Level Classification E-value
Superfamily Moesin tail domain 0.0301
Family Moesin tail domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A064CPI1
Sequence length 269
Comment (tr|A0A064CPI1|A0A064CPI1_9MYCO) Uncharacterized protein {ECO:0000313|EMBL:KDF00718.1} KW=Complete proteome OX=1440774 OS=Mycobacterium aromaticivorans JS19b1 = JCM 16368. GN=Y900_017670 OC=Mycobacterium.
Sequence
MENASDLADLWGDVTGVGAGTWLAVAAWAAVLLGLAALIYAHRQIRRQQRANAKQARPHV
AMFMEPHSADWHVIELVVRNYGSTAAFDVGFAFPKPPTVARYEHTEDGFTDIVELTLPQS
IPELAPTQEWRTVWDSALDRSQFGESIDSRFEELVSYHDQPEPQGWWARTFGRKRTVYRT
KVALDWDTLQPVHRVEMMTGHDLARREREKLELLRNMLDYFHFATKETRVDVLREEIARM
KRAAEETQSRWRRERFEQPTEVVRLPRHG
Download sequence
Identical sequences A0A064CPI1
WP_036343400.1.28968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]