SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A066RX68 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A066RX68
Domain Number 1 Region: 6-117
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 2.62e-40
Family N-utilization substance G protein NusG, N-terminal domain 0.00011
Further Details:      
 
Domain Number 2 Region: 125-180
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 7.02e-20
Family N-utilization substance G protein NusG, C-terminal domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A066RX68
Sequence length 181
Comment (tr|A0A066RX68|A0A066RX68_9GAMM) Transcription termination/antitermination protein NusG {ECO:0000256|HAMAP-Rule:MF_00948, ECO:0000256|RuleBase:RU000538, ECO:0000256|SAAS:SAAS00126873} KW=Complete proteome; Reference proteome OX=1654360 OS=Photobacterium galatheae. GN=EA58_08760 OC=Vibrionaceae; Photobacterium.
Sequence
MSEAPKKRWYVVQAFSGFEGRVAQSLREHIKMHGMEDYFDEVLVPTEEVVEMRAGQRRKS
ERKFFPGYVLVQMVMNDETWHLVRSIPRVMGFIGGTSDRPAPISDKEAAAILNRLQQASE
SPVHKTVFEPGEVVRVTDGPFADFNGVVEEVDYDKSRLKVSVSIFGRATPVELEFGQVEK
N
Download sequence
Identical sequences A0A066RX68
WP_036751338.1.33314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]