SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A066TD75 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A066TD75
Domain Number 1 Region: 11-135
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000000641
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A066TD75
Sequence length 174
Comment (tr|A0A066TD75|A0A066TD75_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:KDN09934.1} KW=Complete proteome OX=1196095 OS=Gilliamella apicola. GN=GAPWKB30_1459 OC=Gilliamella.
Sequence
MILKLEETQQQLTDEELNEFSQFVGNKIPDDFINFYRQFNGGTFIQLDSKMSNYVDDKFL
INFFSIKYGLTIENIYAQFKRDFPQLQDMLPFASDLYLNCYLLSLRPQDNGCVYYWSVIE
QKLTLQFESFNCFILFLDEILQSLDKKYKKDRQLDILIWVWVIASIALYIYFQK
Download sequence
Identical sequences A0A066TD75
WP_080702355.1.100467 WP_080702355.1.35759 WP_080702355.1.92374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]