SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A066TDW4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A066TDW4
Domain Number 1 Region: 3-129
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, catalytic domain 1.11e-25
Family Thiamin pyrophosphokinase, catalytic domain 0.0016
Further Details:      
 
Domain Number 2 Region: 143-202
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, substrate-binding domain 0.0000000942
Family Thiamin pyrophosphokinase, substrate-binding domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A066TDW4
Sequence length 206
Comment (tr|A0A066TDW4|A0A066TDW4_9GAMM) Thiamine pyrophospokinase {ECO:0000313|EMBL:KDN10228.1} KW=Complete proteome OX=1196095 OS=Gilliamella apicola. GN=GAPWKB30_1165 OC=Gilliamella.
Sequence
MSQNRALLFINGEPPQHDFHHLDNYAYIACTDGAYHNYLSTLSIEPNFIIGDLDSYNPNK
AIPPKTQIIHTPDQNKTDFEKAILFLAGKGVKAFDVYGASGHASDHFLGNISVAIRYYHQ
YQITFYDNYCHFFFAKHHQEITNVKDHIISLMPFSKVTGVTITGFQYPLIDATLSLGGVV
SLRNKAISDLIKISFKNGDLMVFVEN
Download sequence
Identical sequences A0A066TDW4
WP_034912490.1.100467 WP_034912490.1.35759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]