SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A066TQT2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A066TQT2
Domain Number 1 Region: 10-73
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000102
Family SMI1/KNR4-like 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A066TQT2
Sequence length 117
Comment (tr|A0A066TQT2|A0A066TQT2_9NEIS) Uncharacterized protein {ECO:0000313|EMBL:KDN11724.1} KW=Complete proteome; Reference proteome OX=1196083 OS=Snodgrassella alvi. GN=SALWKB12_1928 OC=Neisseriaceae; Snodgrassella.
Sequence
MPRKQTENLKFFEVESHKYQLNNPIRIEQVTAIEQKYGFQLPPCYKTFITQIGNGGNANA
YAAGPFYGIYSLQRSIDELDGFNAPNGVQRACIIYPFMPNDYWQQQLHVIKNNDFTT
Download sequence
Identical sequences A0A066TQT2
WP_037407905.1.12117 WP_037407905.1.44639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]