SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A066V2J8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A066V2J8
Domain Number 1 Region: 80-140
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000131
Family SH3-domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A066V2J8
Sequence length 190
Comment (tr|A0A066V2J8|A0A066V2J8_9HOMO) Uncharacterized protein {ECO:0000313|EMBL:KDN34473.1} KW=Complete proteome; Reference proteome OX=1287689 OS=Rhizoctonia solani AG-8 WAC10335. GN=RSAG8_12450 OC=Agaricomycetes; Cantharellales; Ceratobasidiaceae; Rhizoctonia.
Sequence
KDTGGGGDRSPAIAALKQLLADVTKEWAVEENRVIGHVTLSPPITADARLITVFEHRASL
SAALAKGLSQVPPLAAVTYAASSNSAIVARISETFPPRVSYELGVHRGDWVAVFETYVEE
WVLCECNGIRGLVPLMCLDLGTPEFRVSQSFDAHHSASTWNGSAFSWSPSLLPPHTLIGA
QAPSPQLVLC
Download sequence
Identical sequences A0A066V2J8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]