SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A066V671 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A066V671
Domain Number 1 Region: 52-140
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000271
Family Ubiquitin-related 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A066V671
Sequence length 172
Comment (tr|A0A066V671|A0A066V671_9BASI) Uncharacterized protein {ECO:0000313|EMBL:KDN37247.1} KW=Complete proteome; Reference proteome OX=1037660 OS=Tilletiaria anomala UBC 951. GN=K437DRAFT_42539 OC=Exobasidiomycetes; Georgefischeriales; Tilletiariaceae; Tilletiaria.
Sequence
MMPSQQPHLQLQSQPQAEPLCQADVPDAQQKQQTERTLDLANPARIATLHTLLATSGQRH
TWTFPANITVKAVKEIIFNEWRQEWPERPPHAASLRLLHLGHFLDDRVALDDVPNVATTL
SSSPSTQVAATVVHLVIRPNWSNATDGADDESLLKSSAAGSSGVGGCRCIIC
Download sequence
Identical sequences A0A066V671
XP_013240312.1.10717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]