SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A066VYK4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A066VYK4
Domain Number 1 Region: 68-167
Classification Level Classification E-value
Superfamily Cyclin-like 0.00000000000000117
Family Cyclin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A066VYK4
Sequence length 216
Comment (tr|A0A066VYK4|A0A066VYK4_9HOMO) Uncharacterized protein {ECO:0000313|EMBL:KDN43869.1} KW=Complete proteome; Reference proteome OX=1287689 OS=Rhizoctonia solani AG-8 WAC10335. GN=RSAG8_05862 OC=Agaricomycetes; Cantharellales; Ceratobasidiaceae; Rhizoctonia.
Sequence
MATTTHYQSRASPRRATKATAHTQSQTKYTSAPADQFYGHEDTAKMCARFITHLFSCPDV
PPATSQSAVTPSLAQFVAYALHRTRLHSSVTFCALYLLSRLKNRFPAARGSSGHRLYISA
FMIASKVICDDTYSNKSWCVVGQGMFTLREINQMEREMCGYLEWCLNVKPEDLRDFELMV
RKEYGSASAVPAPVAGQGRLPADRSQPFAYAAPSVW
Download sequence
Identical sequences A0A066VYK4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]