SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A066VZZ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A066VZZ8
Domain Number 1 Region: 7-65
Classification Level Classification E-value
Superfamily Preprotein translocase SecE subunit 0.0000000000000366
Family Preprotein translocase SecE subunit 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A066VZZ8
Sequence length 70
Comment (tr|A0A066VZZ8|A0A066VZZ8_9BASI) Protein translocase SEC6 {ECO:0000313|EMBL:KDN44364.1} KW=Complete proteome; Reference proteome OX=1037660 OS=Tilletiaria anomala UBC 951. GN=K437DRAFT_257068 OC=Exobasidiomycetes; Georgefischeriales; Tilletiariaceae; Tilletiaria.
Sequence
MSEKVKEFIDIPQSFIKEGTQFMTRCTKPNQKEYIQICRAVGMGFVVMGFIGYFVKLIHI
PINNILVGGA
Download sequence
Identical sequences A0A066VZZ8
XP_013242734.1.10717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]