SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A066W9G1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A066W9G1
Domain Number 1 Region: 34-66,137-207
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000000000000366
Family Regulator of G-protein signaling, RGS 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A066W9G1
Sequence length 411
Comment (tr|A0A066W9G1|A0A066W9G1_9HOMO) Uncharacterized protein {ECO:0000313|EMBL:KDN47395.1} KW=Complete proteome; Reference proteome OX=1287689 OS=Rhizoctonia solani AG-8 WAC10335. GN=RSAG8_03535 OC=Agaricomycetes; Cantharellales; Ceratobasidiaceae; Rhizoctonia.
Sequence
MYAAKLSRWAGRRATRKLVKQIRLVNILSGDACSPLGLEEFEAYVALQEHSLENLQFIIW
YLDYQHRFFALSAEEQALSPPVARPSNLMPPTPTYGRGKMSPLDSHSPSDWALSPTSSSS
TSSWSPWSPISIPSPVPLKDQPFRNETLQIVATFIRPGATTVLNLDTDVKEELLRGLEKS
THPDVFAPAYARIYELVDECSVPNFVSNAAANINIPKQIYWYAIGIIFTLISWLIAIFTI
YFIPDHPRSKRSIRLVSVPFAVLGCMQIYSAWRGFCSQVFGRSARQLHAWELVDPTDAGV
SLQTLVPIPALPAKPPPLRSVMDMVAGTNRHATAPFTNLSSTSSLEMADMSSKSGAGVSS
GPRIAIIDVEPQTRAGRAAFRRPAVYGPERVVEDPCKLWSLFLLCPRNPLL
Download sequence
Identical sequences A0A066W9G1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]