SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A066WRM4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A066WRM4
Domain Number 1 Region: 1-139
Classification Level Classification E-value
Superfamily SNARE-like 1.1e-45
Family Clathrin coat assembly domain 0.00000227
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A066WRM4
Sequence length 143
Comment (tr|A0A066WRM4|A0A066WRM4_9BASI) AP complex subunit sigma {ECO:0000256|PIRNR:PIRNR015588} KW=Complete proteome; Reference proteome OX=1037660 OS=Tilletiaria anomala UBC 951. GN=K437DRAFT_231002 OC=Exobasidiomycetes; Georgefischeriales; Tilletiariaceae; Tilletiaria.
Sequence
MIRFILVQNKQGKSRLSKFYVPYDDDEKVKLKGEVHRLIAPRDTRHQSNFVEFRSHKIVY
RRYAGLFFCVCVDANDNELAYLEAIHLFVEVLDTFFGNVCELDLVFNFYKVYAILDEVFL
AGEIEETSKSVVLNRLDYLERLE
Download sequence
Identical sequences A0A066WRM4
XP_013246149.1.10717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]