SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A066WVF8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A066WVF8
Domain Number 1 Region: 101-197
Classification Level Classification E-value
Superfamily SH3-domain 8.27e-21
Family SH3-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A066WVF8
Sequence length 268
Comment (tr|A0A066WVF8|A0A066WVF8_COLSU) Putative SH3 domain-containing protein {ECO:0000313|EMBL:KDN60878.1} KW=Complete proteome; Reference proteome OX=1173701 OS=Colletotrichum sublineola (Sorghum anthracnose fungus). GN=CSUB01_07480 OC=Colletotrichum.
Sequence
MDRQTIIETNRSLRTIKNELENLLEKGVISENAYDNIHATLPAETPLHGAASRAANNNAT
PVQNNNPTSPPPTEAMAALNVNPSPAPPSYGQTGPPSLPARTNEKPVLAHARALYRYAGA
DARDVAFERDDRIAIHEYMNADWWMGRNLRTGQEGIFPKTYVLVEQDSAKGAFAPPPAQP
QYAPQQNQWAPQPQYGMPQPQYAQPQGPPPQQNPYNADAPPQAVADQSTGGKDGKGAEMG
KKFGKKLGNAAIFGAGATIGSNIVNSIF
Download sequence
Identical sequences A0A066WVF8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]