SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A066WXI9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A066WXI9
Domain Number 1 Region: 16-68,175-257
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.83e-23
Family Regulator of G-protein signaling, RGS 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A066WXI9
Sequence length 371
Comment (tr|A0A066WXI9|A0A066WXI9_COLSU) Uncharacterized protein {ECO:0000313|EMBL:KDN61603.1} KW=Complete proteome; Reference proteome OX=1173701 OS=Colletotrichum sublineola (Sorghum anthracnose fungus). GN=CSUB01_01428 OC=Colletotrichum.
Sequence
MENRSNGTGQSGTPSPQPDLHRNRLPTLFEVLSRRTLPPVDLFSFYIFMRDQQKSVDYLD
FWLDVAQHMSLCRHYVRELRRSVLIGTPDLDKAGSKRSSAILEGLGEMSHSAAGPSMYAS
EKEKNQDAQMSAYLREEAHEDSAHSSNGDYRGRRSGSGAFSTPREVTTDSNSPAHTVARQ
DIRASAEKILYTFLLPGAEREIILPGSITQDVTTAIEDFGRDDPEVFDVAKDYVFQAMER
DAFPNFLRMKALGNLIPTTLQIRMILGLLSMFGGFWAAFILIFLDADRLTRCWLILPFTI
GVYFLASYQYSLDPVLALIGLSEYTPFNFSKIREPYVRKLLIKRAIMVLSVTILIDAALC
VLFILVPGKRL
Download sequence
Identical sequences A0A066WXI9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]