SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A066X2H1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A066X2H1
Domain Number 1 Region: 1-112
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1e-36
Family Calponin-homology domain, CH-domain 0.0000344
Further Details:      
 
Domain Number 2 Region: 158-224
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 6.54e-17
Family EB1 dimerisation domain-like 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A066X2H1
Sequence length 238
Comment (tr|A0A066X2H1|A0A066X2H1_COLSU) Putative EB1-like domain-containing protein {ECO:0000313|EMBL:KDN60170.1} KW=Complete proteome; Reference proteome OX=1173701 OS=Colletotrichum sublineola (Sorghum anthracnose fungus). GN=CSUB01_07127 OC=Colletotrichum.
Sequence
QELIQWLNQLLSLNITKVEQCGTGAALCQVFDSIFMDVPMSRVKFNVNSEYAYIQNFKVL
QNTFAKHQVDKPIPVEALVKCKMQDNLEFLQWTKKFWDLNFPDHEYDAVARRKGAPVPSG
GGPAPRAASGAGGAARRGGTTPLGGARVPKAAGPGTAALQQENATLKETVVGLERERDFY
FSKLRDIELLVQQAVEEDPELEKQEDGLVKQIQTILYSTEEGFEIPAEGEAVDDQETF
Download sequence
Identical sequences A0A066X2H1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]