SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A066XPY6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A066XPY6
Domain Number 1 Region: 881-992
Classification Level Classification E-value
Superfamily PX domain 1.22e-25
Family PX domain 0.00055
Further Details:      
 
Domain Number 2 Region: 418-565
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.18e-20
Family Regulator of G-protein signaling, RGS 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A066XPY6
Sequence length 1228
Comment (tr|A0A066XPY6|A0A066XPY6_COLSU) Uncharacterized protein {ECO:0000313|EMBL:KDN68065.1} KW=Complete proteome; Reference proteome OX=1173701 OS=Colletotrichum sublineola (Sorghum anthracnose fungus). GN=CSUB01_08225 OC=Colletotrichum.
Sequence
MALQGRDLILAYITCFIAWGHAVSWLPTLRWMGYALVGGVVLATVILFALILLTSRGSRR
GLRHRSPRPNGPAFLASKTWAREVASLQTRQAYSRVPLDPDSRRISKALDDLLELIIRDF
VSSWYSNISKNPVFSNEVDKAVRGALISIRERLLELDLVDIVTTRIVPILTAHFRDFYEA
ERAVRGKKLNRSVTESEELDLAIASKYKDGKLHPAASLSFPDTKLVQQDYLRNLVSGILP
KVLPPNVLASRAVFTIIREIVACAVLFPVMQILAEPDTWNQVMENYGRSMLQDRSTVRKL
RAALDQHASPTPRSSKATIIPRLLPTDSERKFEKFIRAIRKVNNLSDARRLRSEVASQLK
RDSLQENQDQVYLRRLEMGKRLLDQRVQLLAAGGSRQASATLPARPVGVPQAVSKLENAS
LVDLLRDASGLSYFMEFMDRHRMMPLVQFWLVVDGFRNPLEDEGQDDEHLPSNLPMWTDS
DRLDLAQIDHTYLAKAELKVSQACRDEVRAFLDAGKSATPEQYYKARKAILRAQAAVLER
MKAQYFQAFKKSDLFYKCLAAQEASASVAHAPIAEASALSEAHPPMYRNSQSYQSKPNPV
TRLAPRLSRPLSRRAGSASDLTNLNTNGGGSESAPRQRHSLDEETPTPLFEDDDFDQDGM
MDSIQSLDQDAGKPVPDTNVVQAMEEALNNIMEDNRPQTAEEFRASLFGPDDTLDRSSLF
SGDNDSQRGSLEVSRSVAQSSKEAEKPSLASLGLVSAASRIGVFVDDDLFGDEDKYLSDE
KDDGDEEGKGDVEDEVHEAAPGDLGLAEAITALSNDIDRLVAQDVIVESLTKKAELTNNT
AELRILRKSKASLQREIRRKELQRQQYVVQESDNSLYGRSTIKIKAIQVGREEDGREFVL
YVVEVQRDAGEKMPAATWMITRRYSEFHELHQKLRSRYPSVRNLDFPRRRMVMKFQSEFL
RKRRAALEQYLRELLMLPEVCRSRDLRAFLSQSVIAQGTDIVDREDKKDMITRLYDSVTD
GVEDILGNIPVLDQLSLAGQNLIAAATNQLNAIPMPVNEDGVSAAEAEAELNAFENKELE
SFIKPICDIFLEVFELNRGNNWLRGRAVVVVLQQLLGGTIERKVRDNVKMLVQEDAILRY
IALLRDSMWPGGEMNKSRQPRTTSEKKKTRTEASLMLATLVPDLAGSVVGRVNAQAASRR
VFATFNNSRLNAHLAFTFMDELVEILFG
Download sequence
Identical sequences A0A066XPY6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]