SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A066XSJ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A066XSJ1
Domain Number 1 Region: 105-148
Classification Level Classification E-value
Superfamily Chromo domain-like 0.000000412
Family Chromo domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A066XSJ1
Sequence length 168
Comment (tr|A0A066XSJ1|A0A066XSJ1_COLSU) Putative chromo domain-containing protein {ECO:0000313|EMBL:KDN68701.1} KW=Complete proteome; Reference proteome OX=1173701 OS=Colletotrichum sublineola (Sorghum anthracnose fungus). GN=CSUB01_12071 OC=Colletotrichum.
Sequence
MWEDMSPAKDAGPIVPKAAAAPGAMRRLALGTEATTDLEADYFGIEELLADRPDPSCNTL
FEIKVCWEGGEETWESERNLQEDAAPTLFAYWSGVKGGRESRMVDKELWHVFQVVSHKTK
PDGNTYLKVAWVGSPDTTWEPEENIREAAVNLVEIRRQTSVLYFWARF
Download sequence
Identical sequences A0A066XSJ1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]