SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A066XVE8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A066XVE8
Domain Number 1 Region: 31-148
Classification Level Classification E-value
Superfamily ISP domain 2.36e-27
Family Rieske iron-sulfur protein (ISP) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A066XVE8
Sequence length 149
Comment (tr|A0A066XVE8|A0A066XVE8_9ACTN) Iron-sulfur protein {ECO:0000313|EMBL:KDN72852.1} KW=Complete proteome; Reference proteome OX=358823 OS=Streptomyces olindensis. GN=DF19_07980 OC=Streptomyces.
Sequence
MTPSTTRRTVLLATGATGAAALVAACGSGGDDNGSASTATPTDQGATGTETARGGKELAS
IDEIPVGGGKIFKDDEVVVTQPEQGQFKAFSAICTHQRCTVGSVSDGTINCPCHGSRFRV
VDGSVANGPATRPLPAEQITVEGNSVRLA
Download sequence
Identical sequences A0A066XVE8
WP_037769988.1.13853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]