SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A066ZQR1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A066ZQR1
Domain Number 1 Region: 172-283
Classification Level Classification E-value
Superfamily OmpA-like 9.16e-28
Family OmpA-like 0.0016
Further Details:      
 
Domain Number 2 Region: 23-129
Classification Level Classification E-value
Superfamily TSP type-3 repeat 1.57e-18
Family TSP type-3 repeat 0.0026
Further Details:      
 
Domain Number 3 Region: 111-170
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000000000772
Family TSP type-3 repeat 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A066ZQR1
Sequence length 306
Comment (tr|A0A066ZQR1|A0A066ZQR1_HYDMR) Uncharacterized protein {ECO:0000313|EMBL:KDN95837.1} KW=Complete proteome; Reference proteome OX=28885 OS=Hydrogenovibrio marinus. GN=EI16_05955 OC=Piscirickettsiaceae; Hydrogenovibrio.
Sequence
MLRTLPLIALCGLPFFAYAQDAENNYANTPAMQTLMDDGEHTKKDVEEYKDLDQDGVPDK
DDFCANTAKGTKVDKHGCELDSDGDGIYDKTDQCPNSAPGVSVNFLGCEGDEDKDGVLDS
KDKCPGTPLGVKVNQYGCKIDNDKDGDGVLDSIDQCPNTPKGYIVNKYGCPPQTKVTIQI
TFPVGSWNIPSTQKELLEREASKLKELQPDEVVLISGFTDNSGKADTNMKLSWERANSVK
DYILNNFSYPKDKFYIMGMGEQSPIASNATKEGREHNRRIEFQVLKMDKLSPIARHEIPP
EMRLKK
Download sequence
Identical sequences A0A066ZQR1
WP_051623036.1.26828 WP_051623036.1.65250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]