SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067BGE2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067BGE2
Domain Number 1 Region: 116-182
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000196
Family Pseudo ankyrin repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A067BGE2
Sequence length 202
Comment (tr|A0A067BGE2|A0A067BGE2_SAPPC) Uncharacterized protein {ECO:0000313|EMBL:KDO17178.1} KW=Complete proteome; Reference proteome OX=695850 OS=Saprolegnia parasitica (strain CBS 223.65). GN=SPRG_17432 OC=Saprolegnia.
Sequence
MVAARVLGSRDLLPLVSAYQRGTPQEILELRALLDAIDLAGLHALLLAADETYSANCFAA
FAAFHKRVSPASLLRVAFTRSRAAAVYYALVHGNLCVVRGMRTSSRAAISNSQWIIAATF
GHFHVIEYLHRHDWANYDQRAMKAAAMRGNLAMVVYLEDLGYWSPHVLRWACTAGQLHVA
EFANDRETTRSLGAGTINDVVR
Download sequence
Identical sequences A0A067BGE2
XP_012212116.1.39859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]