SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067BKX6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067BKX6
Domain Number 1 Region: 1-80
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 1.57e-19
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.00017
Further Details:      
 
Domain Number 2 Region: 81-172
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.94e-16
Family Cold shock DNA-binding domain-like 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A067BKX6
Sequence length 178
Comment (tr|A0A067BKX6|A0A067BKX6_SAPPC) Uncharacterized protein {ECO:0000313|EMBL:KDO19114.1} KW=Complete proteome; Reference proteome OX=695850 OS=Saprolegnia parasitica (strain CBS 223.65). GN=SPRG_15027 OC=Saprolegnia.
Sequence
MFFLKQLRRELLLHPMHFGPKLHDIIRLRLIEEVEGTSLGKYGYVIAVTEVRDEDIGQGV
IQDNSGFVCFDIAYRAILFRPFKNEVLDAVVTVVNPLGFFAEVGPLQVFVSRHAMSTDLT
EGYDHENSAWISQDREVEIRKGVGVRLKIMGVSIDVTEINAIGTIKDNYLGVISADMF
Download sequence
Identical sequences A0A067BKX6 A0A1V9YMC4 T0QU09
XP_008608533.1.67053 XP_012210186.1.39859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]