SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067BQH7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067BQH7
Domain Number 1 Region: 73-171
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000745
Family Pseudo ankyrin repeat 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A067BQH7
Sequence length 191
Comment (tr|A0A067BQH7|A0A067BQH7_SAPPC) Uncharacterized protein {ECO:0000313|EMBL:KDO16942.1} KW=Complete proteome; Reference proteome OX=695850 OS=Saprolegnia parasitica (strain CBS 223.65). GN=SPRG_17599 OC=Saprolegnia.
Sequence
WPTGPSNASPLPDHELDACFRTWLAAHDVEELAPLLRNAKLQTGLRRFAFVHGDLNVVAF
VAEATCVVAADWLLAASKGHTSVLDWLEARSSAYPRGLMECGVSSNQLDVVVWAHKRQLD
VAGNLRTVAAERGFLEILIYLDAHSLSGWDPMGVSIAAERGHVDVLCFLRAKAYAGTGPV
LVDGGSDVRFM
Download sequence
Identical sequences A0A067BQH7
XP_012212348.1.39859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]