SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067BQV7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067BQV7
Domain Number 1 Region: 246-370
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 9.3e-31
Family cAMP-binding domain 0.0000731
Further Details:      
 
Domain Number 2 Region: 124-243
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.27e-30
Family cAMP-binding domain 0.0000862
Further Details:      
 
Domain Number 3 Region: 9-48
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000811
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A067BQV7
Sequence length 387
Comment (tr|A0A067BQV7|A0A067BQV7_SAPPC) Uncharacterized protein {ECO:0000313|EMBL:KDO16671.1} KW=Complete proteome; Reference proteome OX=695850 OS=Saprolegnia parasitica (strain CBS 223.65). GN=SPRG_00979 OC=Saprolegnia.
Sequence
MADAEGVQQELQDYLQKKGINTLFINIVESLLLSKPDNPVLHIIQYLQTNFPEQATVRAA
EAPAIATGHHSDESESEDEGEEDAVGEMQEAQPAARTFPKGRRISVSAEALDPDNAKPLD
AVVHPKSEEERKRISDILVDNILFKSLDEKQSKILLDAMFPKEFAVGDVIIKQGDDGDNF
YILDTGVCEVYKDDNLVLTCTEAMSFGELALMYNAPRAATVKVKENAKVWALDRQTFKYI
IMETTMKKRDQYKGFIEKVPLLESLSEYERLTVADALRVATFNDGEIIIRQGDDGNLFYI
ISEGTAVCTKQVSPSDPVQEIGLLSTGAYFGEIALLTTRPRQATVTAKGQVKCLTLDRKT
FKRVMGPLENILKRNLAQYNLVMANTI
Download sequence
Identical sequences A0A067BQV7
XP_012194576.1.39859 XP_012212621.1.39859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]