SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067BXM5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067BXM5
Domain Number 1 Region: 40-50,77-152
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000445
Family Pseudo ankyrin repeat 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A067BXM5
Sequence length 176
Comment (tr|A0A067BXM5|A0A067BXM5_SAPPC) Uncharacterized protein {ECO:0000313|EMBL:KDO19317.1} KW=Complete proteome; Reference proteome OX=695850 OS=Saprolegnia parasitica (strain CBS 223.65). GN=SPRG_14709 OC=Saprolegnia.
Sequence
MAVGLACQRYRRQLGHVSHKAHPEVTHLMSTPARFHGFVLCKLIQDRDVPTALALLATFP
DAATLQLPRGKQTYTYTMDYAARARSLPLLKALHARRLGSCSNAAMDTAAANGDVAILDF
LQAYTHQRCTHKGIAAARRNKHVDVLALLEEGRERCREHNDMSGAQFGFAASCAVQ
Download sequence
Identical sequences A0A067BXM5
XP_012209991.1.39859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]