SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067BZ05 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067BZ05
Domain Number 1 Region: 73-256
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.68e-62
Family Nucleotide and nucleoside kinases 0.00000542
Further Details:      
 
Domain Number 2 Region: 29-65
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000157
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A067BZ05
Sequence length 264
Comment (tr|A0A067BZ05|A0A067BZ05_SAPPC) Uncharacterized protein {ECO:0000313|EMBL:KDO23729.1} KW=Complete proteome; Reference proteome OX=695850 OS=Saprolegnia parasitica (strain CBS 223.65). GN=SPRG_10507 OC=Saprolegnia.
Sequence
MDQVTLTFEELSILNERKEEIKRDHLEYLDAHPELKTLMSSFMCAVLMEKPADVVAFAKA
HFDALAPMKIAPAPLVIAGPSGVGKGTLINRLMAKYPELFGFSVSHTTRGPREGEINGVA
YHFVTIDEFDGQVAKNAFLEHANVHGNRYGTSKFAVEHVQAQEKICILDIDVQGVRQVQG
AQLKKVNYLFVAPPSMADLEKRLRGRGTETEDKIKIRLANAKGEVDFAGEGHFDKVLVNN
DLDDAFAELEETLFKWYPEVRFQQ
Download sequence
Identical sequences A0A067BZ05
XP_012205547.1.39859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]