SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067C0N6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067C0N6
Domain Number 1 Region: 80-179
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000484
Family Pseudo ankyrin repeat 0.017
Further Details:      
 
Domain Number 2 Region: 220-259
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000908
Family PHD domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A067C0N6
Sequence length 301
Comment (tr|A0A067C0N6|A0A067C0N6_SAPPC) Uncharacterized protein {ECO:0000313|EMBL:KDO20116.1} KW=Complete proteome; Reference proteome OX=695850 OS=Saprolegnia parasitica (strain CBS 223.65). GN=SPRG_22343 OC=Saprolegnia.
Sequence
MQCVWHSTDLLREIMSFQLGVPYDTHTLLHALRSLVWDNADVLATLPPALAPIHDIFPAW
FKVHGARGLKRMPFSIALELFYYGLYYGHLDVIRHFCDKLPVDYVEWHLVIMSGNVVAVK
FLLDAYPDGCFFQTIERAIEHGHLGVVRALRAHGVPWPATAWKVASQHGRADIASYLDAY
KCPWHEHWRGEVAEAAAEGGHVDVLRPVRKRGLILKLTKPLDHAMLILCDNCDGEFSMPH
IGLDAVPRGAWFCRHCRPQITGALPEPLTDDDDDDDDGDNASLGSKKRHVGSESPKKKRR
V
Download sequence
Identical sequences A0A067C0N6
XP_012209181.1.39859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]