SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067C5M4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067C5M4
Domain Number 1 Region: 1560-1822
Classification Level Classification E-value
Superfamily Rap/Ran-GAP 2.62e-78
Family Rap/Ran-GAP 0.0000652
Further Details:      
 
Domain Number 2 Region: 1365-1467
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000000432
Family Regulator of G-protein signaling, RGS 0.0037
Further Details:      
 
Domain Number 3 Region: 99-162,327-475,530-703,775-893
Classification Level Classification E-value
Superfamily ARM repeat 0.000000134
Family PBS lyase HEAT-like repeat 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A067C5M4
Sequence length 1842
Comment (tr|A0A067C5M4|A0A067C5M4_SAPPC) Uncharacterized protein {ECO:0000313|EMBL:KDO25808.1} KW=Complete proteome; Reference proteome OX=695850 OS=Saprolegnia parasitica (strain CBS 223.65). GN=SPRG_08751 OC=Saprolegnia.
Sequence
MQGAGHQITSPSPGVALEAKKLARFFSEDKPPRKRLATALEFLKSSGPDQQDLFWRDVVN
GSTFFSVLHAYLTELETMYVVMDKASVINKLRNRKFQTEDWTDVFEGLEILIKSNKSLLA
SGWQHNRFLTIFQKLLLADNMPFIKKYAFRCLALYADILMDADFDMRNTATLLDSTSTEN
VQLGFGFSHLDLLAESIDFSPYASGNANVYLPPRHYTEGAVVGWERPGPTQAEEPVDMLK
YVMDLSLERSDNIKDVDVQRFMFWCNVLMGSFMPLLYPKVCIEVGFKEKTDKLGFFHHCP
GSFQRVMARWLYKLRSKQKFMDALWSRKDYVDVVMETLRQRFAYRDPELIVDGIKFYAQL
CKGTQYMPPVMKANLHELHRSMIGHVSQVFHPGAQFDDSNIFLIGIELMELLSQQHLHVH
SFAVLRKAVLATTDASYCLRDNPPGQVVLTPMVSTVFHTWIHGLAQPNGASVEVWAELAT
MVKKWLLNPTTSIAFGLELIRRWKLELLTLSHVLQLYLAAAVDKEEMGREFSSFLIHDVA
VDADRSVLVVDRLLHVLSPSTIASLRPQLSTAVQDAVLEVVRFWSDKPHLASPSTIVALY
GEWFLPACDLTSSEMEKTRCVALETACTILTQRAAATLIPAHAATLARILLSALQDDSRT
NVVSTVLHHGAELFTRSIPGVLVLVPAFLRTIDLMIGSVGALHRNLLVGGDKSNGNRRMP
RFGNEMKRNMLSSMEILFALLPLPAQFPELPELSVASQLETLPDDVHIPAMDAELHDVAG
RCFTRILEFTFPDVTEVQQRALWGLYVLIVVQLNTAPSPLVKQYVVLLCDTCASSDAGLA
LTALSVVHALHRFHASLLAYEPALVQHIIMALSLLVQQQVEDASNVVREILETAPTEPTS
PMASLTHSTSESSVHAQGGRKRSNSWSGSVRGLEKATPESNSFKAAENPVLKTIVAKTTA
VFETLSDWVIECDTILNDAAVLKLLFDALEAALIGSIPDGAWQLQVEQQRTAERKMDMPL
LFLGLAMRASLDGDRHKPSLQCFSDIAMAAEGFLMHLMHHLHGFPSPAGVDQLVSSCTEF
PDEPEALPPNALSFIYMNSIVLTVVGSVDAATARIVARDMTGTYTWDAAMPLASPTPLPS
QTTGDADVGSAMDEPWTKHLPPRASPDRERLEVVMDHALVLATQPSSDVCPLCGGRLLEK
PAQPSAEKVTQMAPFPVLRKTVPKGNTLPSMPQYVFHEENHGSNNNNGLHDTYVCKCDPD
ELQAKSTLPTEVTNATSICNLFCLPDAAKNSVGGLDHERSLLDLLVDSIPMHFRDCGGDL
IDKTLLGGRFTMQKYLDMEWDDMYTQDGGPLQRDATEVPGFSFVQRLLHDEECYAYLKTF
LQKEEKGKELIEFCDGVKKYERSFEGNDRVSQATLLYWEFFSPESVSFTAFPFQIASKLQ
HALQAAQATDAKALPLNLFQDAMDHVEDKCFLGEGRLDRFVAMLNDAHAKSLHPPADGNW
NAFVVPPQLALYDAFSVMELNVRICAETLHVKKSNTLLQPALPSSSSIALPAASKMRISP
LDVCRLWLAQLGILPNESTVGQNHVLILENGVKLERSLKHLDKTPSRETIKIGVVYVGKH
QSQQHEILSNTHGSAEYEEFLLELGWPITLATHKGFPGGLDHNPKSLSNGPSTIYYANST
TEVVFHVVTKMPTKANDPQQIDKKRHVGNDHVHIVWSDNPQAYNQSTITSNFNFVQIVVF
PLRQTSTGLFLINVLTKPDVPLFGPLMDGMVVTRRDLPELLRQTVMNANRACRQQSAWYL
PPYPTRRKLIDEIVDRYATDYSEKSMLTSLFKIPSPAEGHSI
Download sequence
Identical sequences A0A067C5M4
XP_012203373.1.39859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]