SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067CI10 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067CI10
Domain Number 1 Region: 229-361
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.23e-21
Family cAMP-binding domain 0.003
Further Details:      
 
Domain Number 2 Region: 493-616
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.01e-16
Family Regulator of G-protein signaling, RGS 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A067CI10
Sequence length 629
Comment (tr|A0A067CI10|A0A067CI10_SAPPC) Uncharacterized protein {ECO:0000313|EMBL:KDO26452.1} KW=Complete proteome; Reference proteome OX=695850 OS=Saprolegnia parasitica (strain CBS 223.65). GN=SPRG_08255 OC=Saprolegnia.
Sequence
MGSRASRVLPNPVPESAKGPRLVRTKHHNTRRKDAVWQSSILASLFCVEPPLQLSGMSLD
VVLLPAMIASGLDRLLIYDGAISATVLGVGDVAFHVQPIVRRATAAYEDAQSLVQFLHDQ
KDVRRFVTDEVLISCVRDTRSHNPHEDNLYILRFVIPKGNHLDVVAKSVLATNIFVHGKV
RALTVSVDAASAPAAMATMAKWRPVASVESFDRSSRDERVAISEDCVRILRASPFFADIS
TRDLTQLADLGTISIVDANVRLMAEGEIGGREMSILLAGTIAVKKTDPAQGTMRTVTVLH
SGSCIGETSFLVHMARTATLVTQAACMLLSLDGSNFLRFLQHFPQVHRKLQGMLCERFVH
NIAAQGSVPFFRAIPLERLVAWAQHCYIEDNVPAHQSVLPIVGKPKFSILLSGSVEHLQG
GTQKSLVSTSGYFGSFGHVPLPPTGPWGSEASTATPCVFLSCDHAATDMVFDRAAVAAIQ
LRLSRQNIDVMPLLNLPDARKAILEFAGAEFSTENIEFLLAVQQFKLSPSLERAMSICNE
FVDARAAQQVNIEAKMREDILVSLAAHKSGRPLSSSPVLFAPSGAIASLFDGAFDEILRL
VRKDTLPRFKKTPLFAALLAAYPLFEHAI
Download sequence
Identical sequences A0A067CI10
XP_012202888.1.39859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]