SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067CMN4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067CMN4
Domain Number 1 Region: 25-119
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 2.51e-30
Family TATA-box binding protein (TBP), C-terminal domain 0.0000298
Further Details:      
 
Domain Number 2 Region: 117-202
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 5.02e-25
Family TATA-box binding protein (TBP), C-terminal domain 0.0000675
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A067CMN4
Sequence length 225
Comment (tr|A0A067CMN4|A0A067CMN4_SAPPC) Uncharacterized protein {ECO:0000313|EMBL:KDO31964.1} KW=Complete proteome; Reference proteome OX=695850 OS=Saprolegnia parasitica (strain CBS 223.65). GN=SPRG_03180 OC=Saprolegnia.
Sequence
MAAKESSLVAPERALDVEEEWSQERLPLHVKNVVGTIDVQVPLDLTTIALNARNTEYNPR
RFAAVIMRLRDPKTTALIFASGKIVITGATTEKNCRIAARKYCKVLQKLNFPAKFEMFKI
CNMMGTSDVRFPIRLEGLLNDHSRFCTYEPELFPGLIFKLVEPKLTFLIFVSGKLVICGA
KETSDMRLALEKMHPLLLEYRKMAPAPSLESLDFEEDADIDQHKI
Download sequence
Identical sequences A0A067CMN4
XP_012197160.1.39859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]