SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067CNJ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067CNJ3
Domain Number 1 Region: 42-130,338-510
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.68e-18
Family Ankyrin repeat 0.008
Further Details:      
 
Domain Number 2 Region: 183-329
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000562
Family Pseudo ankyrin repeat 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A067CNJ3
Sequence length 559
Comment (tr|A0A067CNJ3|A0A067CNJ3_SAPPC) Uncharacterized protein {ECO:0000313|EMBL:KDO32239.1} KW=Complete proteome; Reference proteome OX=695850 OS=Saprolegnia parasitica (strain CBS 223.65). GN=SPRG_02717 OC=Saprolegnia.
Sequence
MASFHDILLGCPHVAASIFGYQEGITEDALPYFDHFHEHVLYATPHGHHEATFMFLNENG
VVERFRPADLALLEQRDSRFPLHLAISRGDIEATQRLVRGAPHVVSVDAIHCAFLHGRAA
IVKYLLDARALSPALFKPLPSPAVTLERVQRRVLCAYDDVELVQLFEVFASPTWTRDSCA
LVLMHRRTRVAEYLYQHYEASLSTLDVCALASKYGLTGMLRLLATRGALTPRAIDVAIQY
GRVEAVHYLRSECRQVASNGVWAKAATRGLVAILERLPLPEDKEVVAAAAANGHLDVLRF
LTSRTIVSLSGAARAAVASHRADVLDFLLSQDPTVDVAFSSTNPVFLMCLLTAAKQGRRS
ILEILFERNAFTPTRAIVDAAASSGSVELVTWLCTVVPDVVTQTPSALMSAVSSGHVDVA
NVLLAHGLELDADTEIVRFHLPKMDEVLAFSIEHQLAIAAQCLHSACAKGRLDVVMRLLP
LFPTATVASMVDVAVGCNHPDVLQLLAERSATCPPEMLLRTLECDAWALFRVLCDFCPVT
DDVLARAVRLAIDDVALLQ
Download sequence
Identical sequences A0A067CNJ3
XP_012196697.1.39859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]