SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067CXS1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067CXS1
Domain Number 1 Region: 353-411,487-539
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000000000392
Family Pseudo ankyrin repeat 0.0081
Further Details:      
 
Domain Number 2 Region: 94-224
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000385
Family Ankyrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A067CXS1
Sequence length 646
Comment (tr|A0A067CXS1|A0A067CXS1_SAPPC) Uncharacterized protein {ECO:0000313|EMBL:KDO34060.1} KW=Complete proteome; Reference proteome OX=695850 OS=Saprolegnia parasitica (strain CBS 223.65). GN=SPRG_01334 OC=Saprolegnia.
Sequence
MAAVNVLVSPDLLGGILAYQDGLSLALLEICRLAETIRLVPSGRVAHKSVRSVITNVPVR
FASLPYLCLYPQPTTTLSTDALFLSPYAADPALPLHLSIVEGNLSHVRQWLASTPHLCTS
ATLELAAAASQGSVLQLLLRSFSHLLTPKVMDLVAMSGDLPLVQYLDARGAACSTAAMDG
AAMHGHLDVVRFLHAARKEGCTTAAATAALMHGHADALRFLLVHRTEGVNADLTYSAPFP
GHVRTRRVVGTKFLEALELASAITPSRTAQETGLQHAVRIKLHVSKPMLDMAIARQDAAM
LRFVLDALDDVASRDDVPERDRWTTSLDLAAYYGDLVTVQHLNKRGIPVSERAMAHASYR
GHLHVMQWLAKQNGSNGSPRNALVLAAAQGHLHVVQWLVAHGYDLDTCDAALTTAAYRGD
VALATYLAPLVPPSDDKDVPLEYVNASLPPHDDRLDKRGDFVTGRAADAAAAQGHLNIIC
ELQKFGHLVSRRALLYAIENGHLSVVEHLTQNDATYQCDVKTLVRALQRGHRSIVTFLVS
ERSSVFALPPTEEDVYRLYIAAASTGDLALLRLIGDTYGRPLTSTLPLRVQERMLLSAAT
NGHLDAVQLLHEMLGFVAVGSIRAVATRLGYQAMRRYTLLRHDPKS
Download sequence
Identical sequences A0A067CXS1
XP_012194944.1.39859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]