SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067D0Y1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067D0Y1
Domain Number 1 Region: 240-359
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000000005
Family Regulator of G-protein signaling, RGS 0.0054
Further Details:      
 
Domain Number 2 Region: 135-233
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000000721
Family Regulator of G-protein signaling, RGS 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A067D0Y1
Sequence length 901
Comment (tr|A0A067D0Y1|A0A067D0Y1_SAPPC) Uncharacterized protein {ECO:0000313|EMBL:KDO32436.1} KW=Complete proteome; Reference proteome OX=695850 OS=Saprolegnia parasitica (strain CBS 223.65). GN=SPRG_02913 OC=Saprolegnia.
Sequence
MNFLTAIKKPENLDSWLFGDDVADPRPPLAPTANRSTPASPAAADHRPSSASTKLAQAAT
MIQDKYKKMAKNNMNYKSISSTYPMPLSKKFRKYLRDKQRAETAMDEKQRRLLQLSEVSR
LRAHAPKTTDDGNYHNVLLFLLELEQERDAARGTPSLLKLFDKYFTAKSECSISATLELT
PELEEMVLASIQNDDIGWIGFRSIQRLAFKRLTREELPRFLKSTEYLEMLQVSEHTAAFV
PLDRFLTNPRAAHYFLLFLMQQRQHFELYFWLHVEYVLKKCTSDVTLFWTLTHDLLKKAS
VDSSAIQAPTKASLADALRLQSKDAALAAFSVAQSEICLVLNASWYERFVKSPLYTLALS
DKAAKTLLDSDSDSDDDDEHVNATKRRSTAVLRDSFSEYDSISDIPNSERPPLVHHVESE
DSDSDDEAPVRLNLESIIRSTSLPDGLQVHYRPNYPLTPMVLREDLVSTPVIDAIVLFKT
ITTETSGTRLELSYVRKDKSPSLPPSPESQRKVSDLAKRIQPYFVPHGKLVSPAPEPDVL
FPFVVLQNGDLGTLYCMCYTTYVARGDAEFIAQGVCVASPFPLIDGLRSIVARHLLDTPT
PLLPDHVRRLYTLPAPSPTSAPLPAPSPNALLHRRHSGTLLDLPAPPRIDFGLAPLFATL
SNALVLEVVANALLEHSILLLSSSLSALTLSAEAIRCLLAPFAWCHIYIPVLPKSLLSYL
HCPTPILVGIHQSCATRDDLPLPSPSSCAIVVDLDRGTLEYLGPRKLQWPNMGLLDDATS
PIRLVDAFATAKAQLDTLLVCPSALQLDAVGPRPSSVLPTTFPNADVRGVFYKLVANLLF
DHTAASLVVGDATESVIIFDEHKFTALRPAYETPFIECLIRTQCFSEIISTHRLDARLEG
H
Download sequence
Identical sequences A0A067D0Y1
XP_012196887.1.39859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]