SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067DFC9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067DFC9
Domain Number 1 Region: 9-187
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000000124
Family Ankyrin repeat 0.0032
Further Details:      
 
Domain Number 2 Region: 242-320
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000366
Family Pseudo ankyrin repeat 0.031
Further Details:      
 
Weak hits

Sequence:  A0A067DFC9
Domain Number - Region: 400-519
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0667
Family LacY-like proton/sugar symporter 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A067DFC9
Sequence length 575
Comment (tr|A0A067DFC9|A0A067DFC9_CITSI) Uncharacterized protein {ECO:0000313|EMBL:KDO40245.1} KW=Complete proteome; Reference proteome OX=2711 OS=Citrus sinensis (Sweet orange) (Citrus aurantium var. sinensis). GN=CISIN_1g037778mg OC=Citrus.
Sequence
PIRRRRLKLYRAALTGDWAVARGIYDVHEGEIRAPISKRKDTALHIAAAAKQYGFVKELV
QRMEPGDLAQENNVGYTALFFAAASGMVELAREIMTHNKAIATEQDDKRVLPIDLAASLG
HEDMVVYLYGQTKNSLNDEDRSHLLVTLIQTDLYDVALRVFEDLHEKSAIGRAANEETAL
HALARKNLNYSHFTKQYQRGFFSAKDIENKRQKALKLVQRLWEKVVLLSDSRISNLIAEP
ELIFDAARQGNLEFLLILIREYPDLIWNIDENGYTIFHTAVLHRRKRIFKLIYQIGAAKD
LILKFEDPKKNNILHLAAMLPPQDRLNIVSGAALQMQRELLWFEEVEKAVQRRSAEAKNE
DGLSPRALFTRKHENLREQGEKWMKDTATSCMLVATLIATVVFAAAFTVPGGNKGDTGFP
FFLEKVSFKIFAISEAISLVSSSASIVNFLSILTSRYTEKDFLRLLPKKLLIGLATLFVS
IAAMMVVFSAAFFIVFKDSRLWVAILVTVIASIPVIMFIVQHCQLLCDVVRSTYVSNSLF
QRDKISLFHKEDEASERQRMTKLCNGRLAIQCLNV
Download sequence
Identical sequences A0A067DFC9
orange1.1g037778m|PACid:18099893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]