SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067DGQ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067DGQ8
Domain Number 1 Region: 398-595
Classification Level Classification E-value
Superfamily HCP-like 0.000000000118
Family HCP-like 0.025
Further Details:      
 
Weak hits

Sequence:  A0A067DGQ8
Domain Number - Region: 47-84
Classification Level Classification E-value
Superfamily RNI-like 0.0022
Family 28-residue LRR 0.052
Further Details:      
 
Domain Number - Region: 149-254
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0497
Family Pseudo ankyrin repeat 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A067DGQ8
Sequence length 630
Comment (tr|A0A067DGQ8|A0A067DGQ8_CITSI) Uncharacterized protein {ECO:0000313|EMBL:KDO40715.1} KW=Complete proteome; Reference proteome OX=2711 OS=Citrus sinensis (Sweet orange) (Citrus aurantium var. sinensis). GN=CISIN_1g047794mg OC=Citrus.
Sequence
MTTQTLVQYFAKTPVRNPTSISYKDISTQIAKTLFNSGIEPFKTTPSLLSNLNSHITHLV
LSDTNLPPHACLHFFNFLRQNPSLYSHRPDLQAHVTLICRLYEAQKFAEMKKVFNYIVTD
ANLRCSIVNLISLIESGNQQPKFVEKFCDLLFRVYADNRLFEDALGVFDYMERSGLKIDE
RSCIAFLLALKRCDHIEMCFKFFRKMVDANVEITVYSISIMIDGLCKRGDVEMARDLMDE
MVVKGIKPNLYTYNTLLNGFVKRKDAVGVNEMLSLMQRDQVAYNVVTYTLLTDWYGNSGK
MVEVEKMFDEMHERGVEADVHVYTTVISWNCKSGNMRRAFTLFDDLTERGIVPNSHIYGA
MIDGVCKVGQVEAAEMLLKDMQRQGLDVNEVIFNTLMNGYCKKGMIDEALKVMAIMEKKG
FEAGPFAYNTIASGLCKVKRYNEAKKWLFTMMERGLALNTVNFSTLIGICCKEGNLEEAK
WLFEDMKMKGVKPNSFTYNTLIHGYSKKGNIKQAYRLKCKMEEMGMTPDVYTYTSLIHGE
RVFGKLDEAMILFNEMIEKGFIPNAVTYTTLITGLSKEGRSDEAFRLYDEMIASGLTPDD
KLCSSLVAFIQPSLSCEGFLKSERINLINS
Download sequence
Identical sequences A0A067DGQ8
orange1.1g047794m|PACid:18134119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]