SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067DMH7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067DMH7
Domain Number 1 Region: 1-42
Classification Level Classification E-value
Superfamily N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 0.0000000124
Family N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A067DMH7
Sequence length 43
Comment (tr|A0A067DMH7|A0A067DMH7_CITSI) Uncharacterized protein {ECO:0000313|EMBL:KDO39816.1} KW=Complete proteome; Reference proteome OX=2711 OS=Citrus sinensis (Sweet orange) (Citrus aurantium var. sinensis). GN=CISIN_1g0288831mg OC=Citrus.
Sequence
MPSHVQVASVPRNNAKNAALYAVKVLGIADEDLLERIRKYVEE
Download sequence
Identical sequences A0A067DMH7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]