SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067EAH0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A067EAH0
Domain Number - Region: 168-212
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00765
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Domain Number - Region: 122-172
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0789
Family Regulator of G-protein signaling, RGS 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A067EAH0
Sequence length 232
Comment (tr|A0A067EAH0|A0A067EAH0_CITSI) Uncharacterized protein {ECO:0000313|EMBL:KDO52078.1} KW=Complete proteome; Reference proteome OX=2711 OS=Citrus sinensis (Sweet orange) (Citrus aurantium var. sinensis). GN=CISIN_1g026845mg OC=Citrus.
Sequence
MGVVEQLVRRHCVLSTRNFGADAVRFFFSNYFKHGTDVDFETTSLRCRLEVADCFCQNFK
DSEDTLQRYPKMKKRSGSKRTVVFLFLCLPFSSTALQLTKDFKESAPGRNLKQVEEDVHE
VHCSRERSRAAWNIIDEYLMPFVEKEQYLISPTCRLHPDNDLYRDQEQHKFHVDVDEWRC
GYCKKKFYEEKYLDKHFENRHYNLLNVVCSLCLDVVFFFFEVMMLCLTQFYF
Download sequence
Identical sequences A0A067EAH0
orange1.1g026845m|PACid:18111928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]