SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067EBH8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067EBH8
Domain Number 1 Region: 57-142
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.15e-24
Family Canonical RBD 0.0022
Further Details:      
 
Domain Number 2 Region: 141-173
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000192
Family Retrovirus zinc finger-like domains 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A067EBH8
Sequence length 244
Comment (tr|A0A067EBH8|A0A067EBH8_CITSI) Uncharacterized protein {ECO:0000313|EMBL:KDO48261.1} KW=Complete proteome; Reference proteome OX=2711 OS=Citrus sinensis (Sweet orange) (Citrus aurantium var. sinensis). GN=CISIN_1g025055mg OC=Citrus.
Sequence
MAKKKKNKSDSDEEDDTFYYRYASTGNAPANPSSSSSADVTSSGPHKKSKGSGGLAPSKS
TVYVSNLDYALTNSDLHTLFSTFGKIARVTVLKDRATRKSRGVAFIQFVQIPDALSAARA
IHGKVLNGRTVNASIAADNGRASSFIKKRVYKDKSRCYECGDEGHLSYECPRNQLGPRER
PMPKKLRRRSDGEDESEFDDGGWASVVDGGAEERLLLMGENESEEKRKKAKRVSYFSDES
DEEE
Download sequence
Identical sequences A0A067EBH8 A0A2H5PQA1 V4SPN4
clementine0.9_019970m|PACid:19276106 orange1.1g026078m|PACid:18129501 XP_006436503.1.91645 XP_006485591.1.29302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]