SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067EFP7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067EFP7
Domain Number 1 Region: 107-213
Classification Level Classification E-value
Superfamily CAD & PB1 domains 4.05e-22
Family PB1 domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A067EFP7
Sequence length 232
Comment (tr|A0A067EFP7|A0A067EFP7_CITSI) Auxin-responsive protein {ECO:0000256|RuleBase:RU004549} KW=Complete proteome; Reference proteome OX=2711 OS=Citrus sinensis (Sweet orange) (Citrus aurantium var. sinensis). GN=CISIN_1g026811mg OC=Citrus.
Sequence
MEAIGLKMDFKETELCLGLPGGGNNKKDEAAALELTPTPKASNKRGFCETAVIDLKLNLQ
SKESSVDLNENFKNPPSNNKNHDKDPAKPSANKAQVVGWPPVRSYRKNAMAETAAFVKVC
MDGAPYLRKVDLKTYKSYQELSDALAKMFSSFTMGNYGSQGMIDFMNESKLMDLLNSSDY
VPTYEDKDGDWMLVGDVPWEMFVDSCKRMRIMKGSEAIGLAPRAMEKCKSRT
Download sequence
Identical sequences A0A067EFP7 A0A2H5PNW0 V4U278
orange1.1g026811m|PACid:18117609 clementine0.9_020623m|PACid:19257404 XP_006420094.1.91645 XP_006489503.1.29302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]