SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067ETG8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A067ETG8
Domain Number - Region: 19-108
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0667
Family SMI1/KNR4-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A067ETG8
Sequence length 154
Comment (tr|A0A067ETG8|A0A067ETG8_CITSI) Uncharacterized protein {ECO:0000313|EMBL:KDO54176.1} KW=Complete proteome; Reference proteome OX=2711 OS=Citrus sinensis (Sweet orange) (Citrus aurantium var. sinensis). GN=CISIN_1g039860mg OC=Citrus.
Sequence
MLPQSSLLKTCRIPPKIELFYGENFKRCSLYDVYYPYKNAYEIWVLFKKKYVVEDAGTQQ
YYIGDFLHYSMVEEKYVSDQIHEYHILVNNIKKEEIFLLEQFKDYIKSSKHKKKQVSLED
VIIHIRIKEKNIIKDVYDKAKEFRSNANLIENTP
Download sequence
Identical sequences A0A067ETG8
orange1.1g039860m|PACid:18095242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]