SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067F1L3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A067F1L3
Domain Number - Region: 48-88
Classification Level Classification E-value
Superfamily STAT 0.0824
Family STAT 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A067F1L3
Sequence length 209
Comment (tr|A0A067F1L3|A0A067F1L3_CITSI) Uncharacterized protein {ECO:0000313|EMBL:KDO57106.1} KW=Complete proteome; Reference proteome OX=2711 OS=Citrus sinensis (Sweet orange) (Citrus aurantium var. sinensis). GN=CISIN_1g048552mg OC=Citrus.
Sequence
MAKKRKSDATRLDEVDRTMYTTFCSAANSLSQLYTQAMNHQRLSFQAGERHALEKLYQWI
LRQQEEGSRVTTVDIVSYLQNELEYGAEEPPMSPRLAVQHQHSQAVLNNSGLPFSSIPYA
PSTVGPGVRSGQPDHQAKNSVFSNALSSPVRRSLQHYDLTQGGYQMPPGNGPRNGDTNNA
HHQQNRDANSPSSDSMDMHADSPGHEFTY
Download sequence
Identical sequences A0A067F1L3
orange1.1g048552m|PACid:18096185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]