SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067FD89 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067FD89
Domain Number 1 Region: 1-48
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000173
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A067FD89
Sequence length 79
Comment (tr|A0A067FD89|A0A067FD89_CITSI) Uncharacterized protein {ECO:0000313|EMBL:KDO64105.1} KW=Complete proteome; Reference proteome OX=2711 OS=Citrus sinensis (Sweet orange) (Citrus aurantium var. sinensis). GN=CISIN_1g0100102mg OC=Citrus.
Sequence
VDECEEKLACQCPECKCKDTWGSYECSCGSGLLYMQEHDTCISKDVRSEASWGFVWMVIL
GLAATGVAGYAFYKYRIRV
Download sequence
Identical sequences A0A067FD89

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]